OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXB1 (NM_012182) Human Mass Spec Standard

Be the first to review this product
SKU
PH314562
FOXB1 MS Standard C13 and N15-labeled recombinant protein (NP_036314)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350667 Rabbit Polyclonal Anti-FOXB1 Antibody
100 ul
$205.00
LY415929 Transient overexpression lysate of forkhead box B1 (FOXB1) (as WB positive control) 100 ug
$436.00

Other products for "FOXB1 or NM_012182"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214562
Predicted MW 35 kDa
Protein Sequence
Protein Sequence
>RC214562 protein sequence
Red=Cloning site Green=Tags(s)

MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDC
FIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSAL
AASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSS
LGTGWPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPI
PTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036314
RefSeq Size 1459
RefSeq ORF 975
Synonyms FKH5; HFKH-5
Locus ID 27023
UniProt ID Q99853
Cytogenetics 15q22.2
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXB1" proteins (3)
SKU Description Size Price
LC415929 Lyophilized FOXB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415929 Transient overexpression lysate of forkhead box B1 (FOXB1) (as WB positive control) 100 ug
$436.00
TP314562 Recombinant protein of human forkhead box B1 (FOXB1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products