OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PGP (NM_001042371) Human Mass Spec Standard

Be the first to review this product
SKU
PH314470
PGP MS Standard C13 and N15-labeled recombinant protein (NP_001035830)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343268 Rabbit Polyclonal Anti-PGP Antibody
100 ul
$585.00
LY420860 Transient overexpression lysate of phosphoglycolate phosphatase (PGP) (as WB positive control) 100 ug
$436.00

Other products for "PGP or NM_001042371"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214470
Predicted MW 33.8 kDa
Protein Sequence
Protein Sequence
>RC214470 representing NM_001042371
Red=Cloning site Green=Tags(s)

MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNS
SKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVAS
VGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGR
FIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTL
TGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035830
RefSeq Size 1041
RefSeq ORF 963
Synonyms AUM; G3PP; PGPase
Locus ID 283871
UniProt ID A6NDG6
Cytogenetics 16p13.3
Summary Glycerol-3-phosphate phosphatase hydrolyzing glycerol-3-phosphate into glycerol. Thereby, regulates the cellular levels of glycerol-3-phosphate a metabolic intermediate of glucose, lipid and energy metabolism. Was also shown to have a 2-phosphoglycolate phosphatase activity and a tyrosine-protein phosphatase activity. However, their physiological relevance is unclear (PubMed:26755581). In vitro, has also a phosphatase activity toward ADP, ATP, GDP and GTP (By similarity).UniProtKB/Swiss-Prot Function
Protein Pathways Glyoxylate and dicarboxylate metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PGP" proteins (3)
SKU Description Size Price
LC420860 Lyophilized PGP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420860 Transient overexpression lysate of phosphoglycolate phosphatase (PGP) (as WB positive control) 100 ug
$436.00
TP314470 Recombinant protein of human phosphoglycolate phosphatase (PGP), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products