OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MT4 (NM_032935) Human Mass Spec Standard

Be the first to review this product
SKU
PH314104
MT4 MS Standard C13 and N15-labeled recombinant protein (NP_116324)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409877 Transient overexpression lysate of metallothionein 4 (MT4) (as WB positive control) 100 ug
$436.00

Other products for "MT4 or NM_032935"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214104
Predicted MW 6.4 kDa
Protein Sequence
Protein Sequence
>RC214104 protein sequence
Red=Cloning site Green=Tags(s)

MDPRECVCMSGGICMCGDNCKCTTCNCKTCRKSCCPCCPPGCAKCARGCICKGGSDKCSCCP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116324
RefSeq Size 294
RefSeq ORF 186
Synonyms MT-4; MT-IV; MTIV
Locus ID 84560
UniProt ID P47944
Cytogenetics 16q13
Summary Seems to bind zinc and copper. Could play a special role in regulating zinc metabolism during the differentiation of stratified epithelia.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MT4" proteins (3)
SKU Description Size Price
LC409877 Lyophilized MT4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409877 Transient overexpression lysate of metallothionein 4 (MT4) (as WB positive control) 100 ug
$436.00
TP314104 Recombinant protein of human metallothionein 4 (MT4), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products