PRMT1 (NM_198319) Human Mass Spec Standard
CAT#: PH314074
PRMT1 MS Standard C13 and N15-labeled recombinant protein (NP_938075)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC214074 |
Predicted MW | 42.3 kDa |
Protein Sequence |
>RC214074 representing NM_198319
Red=Cloning site Green=Tags(s) MVGVAEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLD VGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWM GYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKE PLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTS PESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_938075 |
RefSeq Size | 1435 |
RefSeq ORF | 1041 |
Synonyms | 6720434D09Rik; ANM1; arginine N-methyltransferase 1; AW214366; HCP1; heterogeneous nuclear ribonucleoproteins methyltransferase-like 2; HRMT1L2; Hrmt1l2; IR1B4; Mrmt1; OTTMUSP00000022387; protein arginine N-methyltransferase 1 |
Locus ID | 3276 |
UniProt ID | Q99873 |
Cytogenetics | 19q13.33 |
Summary | This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405016 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC405017 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC419868 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405016 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 3 |
USD 436.00 |
|
LY405017 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 2 |
USD 436.00 |
|
LY419868 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 1 |
USD 436.00 |
|
PH324239 | PRMT1 MS Standard C13 and N15-labeled recombinant protein (NP_001527) |
USD 3,255.00 |
|
TP314074 | Recombinant protein of human protein arginine methyltransferase 1 (PRMT1), transcript variant 2, 20 µg |
USD 867.00 |
|
TP324239 | Recombinant protein of human protein arginine methyltransferase 1 (PRMT1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review