OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

YY1 associated factor 2 (YAF2) (NM_005748) Human Mass Spec Standard

Be the first to review this product
SKU
PH314071
YAF2 MS Standard C13 and N15-labeled recombinant protein (NP_005739)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329295 Rabbit Polyclonal anti-YAF2 antibody
100 ul
$525.00
LY417096 Transient overexpression lysate of YY1 associated factor 2 (YAF2) (as WB positive control) 100 ug
$436.00

Other products for "YY1 associated factor 2 or NM_005748"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214071
Predicted MW 19.7 kDa
Protein Sequence
Protein Sequence
>RC214071 representing NM_005748
Red=Cloning site Green=Tags(s)

MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP
PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS
SAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005739
RefSeq Size 4096
RefSeq ORF 540
Locus ID 10138
UniProt ID Q8IY57
Cytogenetics 12q12
Summary This gene encodes a zinc finger containing protein that functions in the regulation of transcription. This protein was identified as an interacting partner of transcriptional repressor protein Yy1, and also interacts with other transcriptional regulators, including Myc and Polycomb. This protein can promote proteolysis of Yy1. Multiple alternatively spliced transcript variants have been found. provided by RefSeq, Feb 2016
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "YY1 associated factor 2" proteins (3)
SKU Description Size Price
LC417096 Lyophilized YAF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417096 Transient overexpression lysate of YY1 associated factor 2 (YAF2) (as WB positive control) 100 ug
$436.00
TP314071 Recombinant protein of human YY1 associated factor 2 (YAF2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products