OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Interferon alpha10 (IFNA10) (NM_002171) Human Mass Spec Standard

Be the first to review this product
SKU
PH314055
IFNA10 MS Standard C13 and N15-labeled recombinant protein (NP_002162)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA377347 IFNA10 Rabbit polyclonal Antibody
100 ul
$410.00
LY419488 Transient overexpression lysate of interferon, alpha 10 (IFNA10) (as WB positive control) 100 ug
$436.00

Other products for "Interferon alpha10 or NM_002171"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214055
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC214055 representing NM_002171
Red=Cloning site Green=Tags(s)

MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQ
FQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI
LAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002162
RefSeq Size 963
RefSeq ORF 567
Synonyms IFN-alphaC
Locus ID 3446
UniProt ID P01566
Cytogenetics 9p21.3
Summary This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted. provided by RefSeq, Aug 2013
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Interferon alpha10" proteins (3)
SKU Description Size Price
LC419488 Lyophilized IFNA10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419488 Transient overexpression lysate of interferon, alpha 10 (IFNA10) (as WB positive control) 100 ug
$436.00
TP314055 Recombinant protein of human interferon, alpha 10 (IFNA10), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products