OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAGE13 (NM_001098412) Human Mass Spec Standard

Be the first to review this product
SKU
PH313979
GAGE13 MS Standard C13 and N15-labeled recombinant protein (NP_001091882)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY420576 Transient overexpression lysate of G antigen 13 (GAGE13) (as WB positive control) 100 ug
$436.00

Other products for "GAGE13 or NM_001098412"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213979
Predicted MW 12.7 kDa
Protein Sequence
Protein Sequence
>RC213979 representing NM_001098412
Red=Cloning site Green=Tags(s)

MSWRGRSTYYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQCQDPAAAQEGEDEGASAGQGP
KPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGKKQSQC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001091882
RefSeq Size 527
RefSeq ORF 351
Synonyms GAGE-12A; GAGE-13; GAGE12A
Locus ID 645051
UniProt ID Q4V321
Cytogenetics Xp11.23
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAGE13" proteins (3)
SKU Description Size Price
LC420576 Lyophilized GAGE13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420576 Transient overexpression lysate of G antigen 13 (GAGE13) (as WB positive control) 100 ug
$436.00
TP313979 Recombinant protein of human G antigen 13 (GAGE13), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products