OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C20orf27 (NM_001039140) Human Mass Spec Standard

Be the first to review this product
SKU
PH313954
C20orf27 MS Standard C13 and N15-labeled recombinant protein (NP_001034229)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422021 Transient overexpression lysate of chromosome 20 open reading frame 27 (C20orf27) (as WB positive control) 100 ug
$436.00

Other products for "C20orf27 or NM_001039140"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213954
Predicted MW 21.5 kDa
Protein Sequence
Protein Sequence
>RC213954 representing NM_001039140
Red=Cloning site Green=Tags(s)

MAAANKGKCLPGVVGLAQALPVGPGRRAIAAGNKPRVRSIRFAAGHDAEGSHSHVHFDEKLHDSVVMVTQ
ESDSSFLVKVGFLKILHRYEITFTLPPVHRLSKDVREAPVPSLHLKLLSVVPVPEGYSVKCEYSAHKEGV
LKEEILLACEGGTGTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYDSEHSDWHGFD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001034229
RefSeq Size 1376
RefSeq ORF 597
Locus ID 54976
UniProt ID Q9GZN8
Cytogenetics 20p13
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C20orf27" proteins (3)
SKU Description Size Price
LC422021 Lyophilized C20orf27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422021 Transient overexpression lysate of chromosome 20 open reading frame 27 (C20orf27) (as WB positive control) 100 ug
$436.00
TP313954 Recombinant protein of human chromosome 20 open reading frame 27 (C20orf27), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products