OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFITM5 (NM_001025295) Human Mass Spec Standard

Be the first to review this product
SKU
PH313834
IFITM5 MS Standard C13 and N15-labeled recombinant protein (NP_001020466)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336050 Rabbit Polyclonal Anti-IFITM5 Antibody
100 ul
$585.00
LY422431 Transient overexpression lysate of interferon induced transmembrane protein 5 (IFITM5) (as WB positive control) 100 ug
$436.00

Other products for "IFITM5 or NM_001025295"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213834
Predicted MW 14.2 kDa
Protein Sequence
Protein Sequence
>RC213834 representing NM_001025295
Red=Cloning site Green=Tags(s)

MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVG
DLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020466
RefSeq Size 733
RefSeq ORF 396
Synonyms BRIL; DSPA1; fragilis4; Hrmp1; OI5
Locus ID 387733
UniProt ID A6NNB3
Cytogenetics 11p15.5
Summary This gene encodes a membrane protein thought to play a role in bone mineralization. This gene is located on chromosome 11 in a cluster of related genes which are induced by interferon, however, this gene has not been shown to be interferon inducible. A similar gene, located in a gene cluster on mouse chromosome 7, is a member of the interferon-inducible fragilis gene family. The mouse gene encodes a transmembrane protein described as participating in germ cell competence. A mutation in the 5' UTR of this gene has been associated with osteogenesis imperfecta type V (PMID: 22863190, 22863195). provided by RefSeq, Aug 2012
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFITM5" proteins (3)
SKU Description Size Price
LC422431 Lyophilized IFITM5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422431 Transient overexpression lysate of interferon induced transmembrane protein 5 (IFITM5) (as WB positive control) 100 ug
$436.00
TP313834 Recombinant protein of human interferon induced transmembrane protein 5 (IFITM5), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products