Cell adhesion molecule 4 (CADM4) (NM_145296) Human Mass Spec Standard

CAT#: PH313683

CADM4 MS Standard C13 and N15-labeled recombinant protein (NP_660339)

Product Images

Coomassie blue staining of purified CADM4 protein (Cat# TP313683). The protein was produced from HEK293T cells transfected with CADM4 cDNA clone (Cat# RC213683) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213683
• Predicted MW: 42.6 kDa
• Protein Sequence:
  Sequence Link

  >RC213683 representing NM_145296
  Red=Cloning site Green=Tags(s)
  
  MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTR
  ALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGE
  VELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGH
  SKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPG
  LVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVR
  QKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKEEFFI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_660339
• RefSeq Size: 2176
• RefSeq ORF: 1164
• Synonyms: IGSF4C; Necl-4; NECL4; synCAM4; TSLL2
• Locus ID: 199731
• UniProt ID: Q8NFZ8
• Cytogenetics: 19q13.31
• Summary: Involved in the cell-cell adhesion. Has calcium- and magnesium-independent cell-cell adhesion activity. May have tumor-suppressor activity.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane