OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cell adhesion molecule 4 (CADM4) (NM_145296) Human Mass Spec Standard

Be the first to review this product
SKU
PH313683
CADM4 MS Standard C13 and N15-labeled recombinant protein (NP_660339)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351025 Rabbit Polyclonal Anti-CADM4 Antibody
100 ul
$205.00
LY403428 Transient overexpression lysate of cell adhesion molecule 4 (CADM4) (as WB positive control) 100 ug
$436.00

Other products for "Cell adhesion molecule 4 or NM_145296"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213683
Predicted MW 42.6 kDa
Protein Sequence
Protein Sequence
>RC213683 representing NM_145296
Red=Cloning site Green=Tags(s)

MGRARRFQWPLLLLWAAAAGPGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTR
ALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGE
VELSCLVPRSRPAATLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGH
SKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPG
LVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVR
QKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKEEFFI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660339
RefSeq Size 2176
RefSeq ORF 1164
Synonyms IGSF4C; Necl-4; NECL4; synCAM4; TSLL2
Locus ID 199731
UniProt ID Q8NFZ8
Cytogenetics 19q13.31
Summary Involved in the cell-cell adhesion. Has calcium- and magnesium-independent cell-cell adhesion activity. May have tumor-suppressor activity.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Cell adhesion molecule 4" proteins (3)
SKU Description Size Price
LC403428 Lyophilized CADM4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403428 Transient overexpression lysate of cell adhesion molecule 4 (CADM4) (as WB positive control) 100 ug
$436.00
TP313683 Recombinant protein of human cell adhesion molecule 4 (CADM4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products