OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TP53TG3 (NM_016212) Human Mass Spec Standard

Be the first to review this product
SKU
PH313671
TP53TG3 MS Standard C13 and N15-labeled recombinant protein (NP_057296)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY414126 Transient overexpression lysate of TP53 target 3 (TP53TG3) (as WB positive control) 100 ug
$436.00

Other products for "TP53TG3 or NM_016212"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213671
Predicted MW 12.8 kDa
Protein Sequence
Protein Sequence
>RC213671 protein sequence
Red=Cloning site Green=Tags(s)

MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPCCFQISPAEET
LELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSSFSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057296
RefSeq Size 1431
RefSeq ORF 372
Synonyms P53TG3; TP53TG3A; TP53TG3E; TP53TG3F
Locus ID 24150
UniProt ID Q9ULZ0
Cytogenetics 16p11.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TP53TG3" proteins (3)
SKU Description Size Price
LC414126 Lyophilized TP53TG3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414126 Transient overexpression lysate of TP53 target 3 (TP53TG3) (as WB positive control) 100 ug
$436.00
TP313671 Recombinant protein of human TP53 target 3 (TP53TG3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products