OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ARL6 (NM_177976) Human Mass Spec Standard

Be the first to review this product
SKU
PH313584
ARL6 MS Standard C13 and N15-labeled recombinant protein (NP_816931)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA324291 Anti-ARL6 Rabbit Polyclonal Antibody
100 ul
$305.00
LY406068 Transient overexpression lysate of ADP-ribosylation factor-like 6 (ARL6), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "ARL6 or NM_177976"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213584
Predicted MW 21.1 kDa
Protein Sequence
Protein Sequence
>RC213584 protein sequence
Red=Cloning site Green=Tags(s)

MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDM
SGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTS
VKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_816931
RefSeq Size 1590
RefSeq ORF 558
Synonyms BBS3; RP55
Locus ID 84100
UniProt ID Q9H0F7
Cytogenetics 3q11.2
Summary The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246). provided by RefSeq, Apr 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ARL6" proteins (7)
SKU Description Size Price
PH305966 ARL6 MS Standard C13 and N15-labeled recombinant protein (NP_115522) 10 ug
$3,360.00
LC406068 Lyophilized ARL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410339 Lyophilized ARL6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406068 Transient overexpression lysate of ADP-ribosylation factor-like 6 (ARL6), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410339 Transient overexpression lysate of ADP-ribosylation factor-like 6 (ARL6), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305966 Recombinant protein of human ADP-ribosylation factor-like 6 (ARL6), transcript variant 1, 20 µg 20 ug
$867.00
TP313584 Recombinant protein of human ADP-ribosylation factor-like 6 (ARL6), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products