OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ACRV1 (NM_020110) Human Mass Spec Standard

Be the first to review this product
SKU
PH313557
ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064495)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA335863 Rabbit Polyclonal Anti-ACRV1 Antibody
100 ul
$585.00
LY402748 Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 8 (as WB positive control) 100 ug
$436.00

Other products for "ACRV1 or NM_020110"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213557
Predicted MW 11.2 kDa
Protein Sequence
Protein Sequence
>RC213557 representing NM_020110
Red=Cloning site Green=Tags(s)

MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGTILNCYTCAYMNDQGKCLRGEGTCITQNS
QQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064495
RefSeq Size 906
RefSeq ORF 363
Synonyms acrosomal vesicle protein 1; D11S4365; SP-10; SPACA2; sperm protein 10
Locus ID 56
UniProt ID P26436
Cytogenetics 11q24.2
Summary This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described. provided by RefSeq, Nov 2010
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ACRV1" proteins (17)
SKU Description Size Price
PH305185 ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_001603) 10 ug
$3,360.00
PH322483 ACRV1 MS Standard C13 and N15-labeled recombinant protein (NP_064492) 10 ug
$3,360.00
LC402748 Lyophilized ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC412644 Lyophilized ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC412647 Lyophilized ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC412655 Lyophilized ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419846 Lyophilized ACRV1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402748 Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 8 (as WB positive control) 100 ug
$436.00
LY412644 Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY412647 Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 10 (as WB positive control) 100 ug
$436.00
LY412655 Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY419846 Transient overexpression lysate of acrosomal vesicle protein 1 (ACRV1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305185 Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 1, 20 µg 20 ug
$867.00
TP313557 Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 10, 20 µg 20 ug
$867.00
TP322483 Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 3, 20 µg 20 ug
$867.00
TP720355 Recombinant protein of human acrosomal vesicle protein 1 (ACRV1), transcript variant 1 10 ug
$275.00
TP761524 Purified recombinant protein of Human acrosomal vesicle protein 1 (ACRV1), transcript variant 8, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products