OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TEX28 (NM_001586) Human Mass Spec Standard

Be the first to review this product
SKU
PH313372
TEX28 MS Standard C13 and N15-labeled recombinant protein (NP_001577)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA355427 TEX28 Antibody - middle region
100 ul
$575.00
LY419852 Transient overexpression lysate of testis expressed 28 (TEX28) (as WB positive control) 100 ug
$436.00

Other products for "TEX28 or NM_001586"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213372
Predicted MW 46.1 kDa
Protein Sequence
Protein Sequence
>RC213372 protein sequence
Red=Cloning site Green=Tags(s)

MVLKAEHTRSPSATLPSNVPSCRSLSSSEDGPSGPSSLADGGLAHNLQDSVRHRILYLSEQLRVEKASRD
GNTVSYLKLVSKADRHQVPHIQQAFEKVNQRASATIAQIEHRLHQCHQQLQELEEGCRPEGLLLMAESDP
ANCEPPSEKALLSEPPEPGGEDGPVNLPHASRPFILESRFQSLQQGTCLETEDVAQQQNLLLQKVKAELE
EAKRFHISLQESYHSLKERSLTDLQLLLESLQEEKCRQALMEEQVNGRLQGQLNEIYNLKHNLACSEERM
AYLSYERAKEIWEITETFKSRISKLEMLQQVTQLEAAEHLQSRPPQMLFKFLSPRLSLATVLLVFVSTLC
ACPSSLISSRLCTCTMLMLIGLGVLAWQRWRAIPATDWQEWVPSRCRLYSKDSGPPADGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001577
RefSeq Size 1558
RefSeq ORF 1230
Synonyms CXorf2; fTEX; MRX99; TEX28P1; TEX28P2
Locus ID 1527
UniProt ID O15482
Cytogenetics Xq28
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TEX28" proteins (3)
SKU Description Size Price
LC419852 Lyophilized TEX28 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419852 Transient overexpression lysate of testis expressed 28 (TEX28) (as WB positive control) 100 ug
$436.00
TP313372 Recombinant protein of human testis expressed 28 (TEX28), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products