OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GATD1 (NM_182612) Human Mass Spec Standard

Be the first to review this product
SKU
PH313338
PDDC1 MS Standard C13 and N15-labeled recombinant protein (NP_872418)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA360678 GATD1 Antibody - middle region
100 ul
$585.00
LY405457 Transient overexpression lysate of Parkinson disease 7 domain containing 1 (PDDC1) (as WB positive control) 100 ug
$436.00

Other products for "GATD1 or NM_182612"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213338
Predicted MW 23.1 kDa
Protein Sequence
Protein Sequence
>RC213338 representing NM_182612
Red=Cloning site Green=Tags(s)

MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESNARWVQDFRLK
AYASPAKLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKPICAVGHGVAALCCATNEDRS
WVFDSYSLTGPSVCELVRAPGFARLPLVVEDFVKDSGACFSASEPDAVHVVLDRHLVTGQNASSTVPAVQ
NLLFLCGSRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872418
RefSeq Size 2598
RefSeq ORF 660
Synonyms PDDC1
Locus ID 347862
UniProt ID Q8NB37
Cytogenetics 11p15.5
Protein Families Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GATD1" proteins (3)
SKU Description Size Price
LC405457 Lyophilized PDDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405457 Transient overexpression lysate of Parkinson disease 7 domain containing 1 (PDDC1) (as WB positive control) 100 ug
$436.00
TP313338 Recombinant protein of human Parkinson disease 7 domain containing 1 (PDDC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products