OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MEMO1 (NM_015955) Human Mass Spec Standard

Be the first to review this product
SKU
PH313245
MEMO1 MS Standard C13 and N15-labeled recombinant protein (NP_057039)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334504 Rabbit Polyclonal Anti-NCDN Antibody
100 ul
$585.00
LY414307 Transient overexpression lysate of mediator of cell motility 1 (MEMO1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "MEMO1 or NM_015955"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213245
Predicted MW 33.7 kDa
Protein Sequence
Protein Sequence
>RC213245 protein sequence
Red=Cloning site Green=Tags(s)

MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSI
TRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYT
AKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIY
RSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCR
NWQDSSVSYAAGALTVH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057039
RefSeq Size 1878
RefSeq ORF 891
Synonyms C2orf4; CGI-27; MEMO; NS5ATP7
Locus ID 51072
UniProt ID Q9Y316
Cytogenetics 2p22.3
Summary May control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. Mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization. Is required for breast carcinoma cell migration.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MEMO1" proteins (5)
SKU Description Size Price
LC414307 Lyophilized MEMO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427942 Lyophilized MEMO1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414307 Transient overexpression lysate of mediator of cell motility 1 (MEMO1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427942 Transient overexpression lysate of mediator of cell motility 1 (MEMO1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP313245 Recombinant protein of human mediator of cell motility 1 (MEMO1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products