OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TAFA3 (NM_182759) Human Mass Spec Standard

Be the first to review this product
SKU
PH313076
FAM19A3 MS Standard C13 and N15-labeled recombinant protein (NP_877436)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336180 Rabbit Polyclonal Anti-FAM19A3 Antibody
100 ul
$585.00
LY403648 Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TAFA3 or NM_182759"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213076
Predicted MW 14.6 kDa
Protein Sequence
Protein Sequence
>RC213076 representing NM_182759
Red=Cloning site Green=Tags(s)

MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRIEERSQTVKCS
CFSGQVAGTTRAKPSCVDASIVLQRWWCQMEPCLPGEECKVLPDLSGWSCSSGHKVKTTKVTR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_877436
RefSeq Size 1077
RefSeq ORF 399
Synonyms FAM19A3; TAFA-3
Locus ID 284467
UniProt ID Q7Z5A8
Cytogenetics 1p13.2
Summary This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Nov 2011
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TAFA3" proteins (5)
SKU Description Size Price
LC403648 Lyophilized FAM19A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423753 Lyophilized FAM19A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403648 Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423753 Transient overexpression lysate of family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP313076 Purified recombinant protein of Homo sapiens family with sequence similarity 19 (chemokine (C-C motif)-like), member A3 (FAM19A3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products