OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C1QL2 (NM_182528) Human Mass Spec Standard

Be the first to review this product
SKU
PH313000
C1QL2 MS Standard C13 and N15-labeled recombinant protein (NP_872334)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316193 Rabbit polyclonal anti-C1QL2 antibody
100 ul
$380.00
LY405505 Transient overexpression lysate of complement component 1, q subcomponent-like 2 (C1QL2) (as WB positive control) 100 ug
$436.00

Other products for "C1QL2 or NM_182528"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213000
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC213000 representing NM_182528
Red=Cloning site Green=Tags(s)

MALGLLIAVPLLLQAAPRGAAHYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPP
PPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQLTAGTASGVGVVGGGAGVGG
DSEGEVTSALSATFSGPKIAFYVGLKSPHEGYEVLKFDDVVTNLGNHYDPTTGKFSCQVRGIYFFTYHIL
MRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFS
GFLLYPD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872334
RefSeq Size 2066
RefSeq ORF 861
Synonyms C1QTNF10; CTRP10
Locus ID 165257
UniProt ID Q7Z5L3
Cytogenetics 2q14.2
Summary May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C1QL2" proteins (3)
SKU Description Size Price
LC405505 Lyophilized C1QL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405505 Transient overexpression lysate of complement component 1, q subcomponent-like 2 (C1QL2) (as WB positive control) 100 ug
$436.00
TP313000 Recombinant protein of human complement component 1, q subcomponent-like 2 (C1QL2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products