OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PIM3 (NM_001001852) Human Mass Spec Standard

Be the first to review this product
SKU
PH312690
PIM3 MS Standard C13 and N15-labeled recombinant protein (NP_001001852)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367121 PIM3 rabbit polyclonal antibody
100 ul
$310.00
LY424253 Transient overexpression lysate of pim-3 oncogene (PIM3) (as WB positive control) 100 ug
$436.00

Other products for "PIM3 or NM_001001852"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212690
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC212690 representing NM_001001852
Red=Cloning site Green=Tags(s)

MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKH
VVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERG
ALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVY
SPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSE
RPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001852
RefSeq Size 2392
RefSeq ORF 978
Synonyms pim-3
Locus ID 415116
UniProt ID Q86V86
Cytogenetics 22q13.33
Summary The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is overexpressed in hematological and epithelial tumors and is associated with MYC coexpression. It plays a role in the regulation of signal transduction cascades, contributing to both cell proliferation and survival, and provides a selective advantage in tumorigenesis. provided by RefSeq, Jun 2012
Protein Families Druggable Genome, Protein Kinase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PIM3" proteins (3)
SKU Description Size Price
LC424253 Lyophilized PIM3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424253 Transient overexpression lysate of pim-3 oncogene (PIM3) (as WB positive control) 100 ug
$436.00
TP312690 Recombinant protein of human pim-3 oncogene (PIM3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products