OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRR3 (NM_025263) Human Mass Spec Standard

Be the first to review this product
SKU
PH312403
PRR3 MS Standard C13 and N15-labeled recombinant protein (NP_079539)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410821 Transient overexpression lysate of proline rich 3 (PRR3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PRR3 or NM_025263"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212403
Predicted MW 20.6 kDa
Protein Sequence
Protein Sequence
>RC212403 protein sequence
Red=Cloning site Green=Tags(s)

MPKRKKQNHHQPPTQQQPPLPEREETGDEEDGSPIGPPSLLGPPPMANGKPGDPKSALHRGPPGSRGPLI
PPLLSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNAEPPFPGPGHGGPTRGSFHKEQRNPRRLKSWSLIK
NTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYEDLCAFYHPGVNGPPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079539
RefSeq Size 3404
RefSeq ORF 564
Synonyms CAT56
Locus ID 80742
UniProt ID P79522
Cytogenetics 6p21.33
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRR3" proteins (5)
SKU Description Size Price
LC410821 Lyophilized PRR3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421446 Lyophilized PRR3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410821 Transient overexpression lysate of proline rich 3 (PRR3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421446 Transient overexpression lysate of proline rich 3 (PRR3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP312403 Recombinant protein of human proline rich 3 (PRR3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products