OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CDRT15 (NM_001007530) Human Mass Spec Standard

Be the first to review this product
SKU
PH312401
CDRT15 MS Standard C13 and N15-labeled recombinant protein (NP_001007531)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY423498 Transient overexpression lysate of CMT1A duplicated region transcript 15 (CDRT15) (as WB positive control) 100 ug
$436.00

Other products for "CDRT15 or NM_001007530"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212401
Predicted MW 20.5 kDa
Protein Sequence
Protein Sequence
>RC212401 representing NM_001007530
Red=Cloning site Green=Tags(s)

MFSCCFPTSRGCCFRNGGSESLFRRCRRRLIPHPRRLSPVVIRRIQVPQDSLGQALAGQATPEIPLGLQL
HTVLVQEIQELIEAQTLAPGPCAEVRALPAPAAEPEPAWEEAPPERALELEGAPAKDQTNEELPEITEVP
ESIKRRLGRRVPAATPAPRGNLLLQAWMRVHSWASRLFAPNVLPGTGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007531
RefSeq Size 567
RefSeq ORF 564
Locus ID 146822
UniProt ID Q96T59
Cytogenetics 17p12
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CDRT15" proteins (3)
SKU Description Size Price
LC423498 Lyophilized CDRT15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423498 Transient overexpression lysate of CMT1A duplicated region transcript 15 (CDRT15) (as WB positive control) 100 ug
$436.00
TP312401 Recombinant protein of human CMT1A duplicated region transcript 15 (CDRT15), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products