OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ENTPD7 (NM_020354) Human Mass Spec Standard

Be the first to review this product
SKU
PH312315
ENTPD7 MS Standard C13 and N15-labeled recombinant protein (NP_065087)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA350173 Rabbit Polyclonal Anti-ENTPD7 Antibody
100 ul
$205.00
LY412525 Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7) (as WB positive control) 100 ug
$665.00

Other products for "ENTPD7 or NM_020354"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212315
Predicted MW 69 kDa
Protein Sequence
Protein Sequence
>RC212315 protein sequence
Red=Cloning site Green=Tags(s)

MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFISCLLLLMLIIDFRHWSASLPRDRQYERYLARVG
ELEATDTEDPNLNYGLVVDCGSSGSRIFVYFWPRHNGNPHDLLDIKQMRDRNSQPVVKKIKPGISAMADT
PEHASDYLRPLLSFAAAHVPVKKHKETPLYILCTAGMRLLPERKQLAILADLVKDLPLEFDFLFSQSQAE
VISGKQEGVYAWIGINFVLGRFDHEDESDAEATQELAAGRRRTVGILDMGGASLQIAYEVPTSTSVLPAK
QEEAAKILLAEFNLGCDVQHTEHVYRVYVTTFLGFGGNFARQRYEDLVLNETLNKNRLLGQKTGLSPDNP
FLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEFYGFSE
FFYCTEDVLRIGGRYHGPTFAKAAQDYCGMAWSVLTQRFKNGLFSSHADEHRLKYQCFKSAWMYQVLHEG
FHFPYDYPNLRTAQLVYDREVQWTLGAILYKTRFLPLRDLRQEGVRQAHGSWFRLSFVYNHYLFFACILV
VLLAIFLYLLRLRRIHHRQTRASAPLDLLWLEEVVPMMGVQVGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065087
RefSeq Size 8564
RefSeq ORF 1812
Synonyms LALP1
Locus ID 57089
UniProt ID Q9NQZ7
Cytogenetics 10q24.2
Summary This gene encodes a purine-converting ectoenzyme which belongs to the ecto-nucleoside triphosphate diphosphohydrolase (E-NTPDase) family. The encoded protein hydrolyzes extracellular nucleoside triphosphates (UTP, GTP, and CTP) to nucleoside monophosphates as part of a purinergic signaling pathway. It contains two transmembrane domains at the N- and C-termini and a large, hydrophobic catalytic domain located in between. This gene affects oxidative stress as well as DNA damage and is a mediator of senescence. provided by RefSeq, Mar 2017
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ENTPD7" proteins (3)
SKU Description Size Price
LC412525 Lyophilized ENTPD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412525 Transient overexpression lysate of ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7) (as WB positive control) 100 ug
$665.00
TP312315 Recombinant protein of human ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products