OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STAC2 (NM_198993) Human Mass Spec Standard

Be the first to review this product
SKU
PH312302
STAC2 MS Standard C13 and N15-labeled recombinant protein (NP_945344)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316362 Rabbit polyclonal anti-STAC2 antibody
100 ul
$380.00
LY404706 Transient overexpression lysate of SH3 and cysteine rich domain 2 (STAC2) (as WB positive control) 100 ug
$436.00

Other products for "STAC2 or NM_198993"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212302
Predicted MW 44.8 kDa
Protein Sequence
Protein Sequence
>RC212302 representing NM_198993
Red=Cloning site Green=Tags(s)

MTEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLENFFLRSGSELKCPTEVLLTP
PTPLPPPSPPPTASDRGLATPSPSPCPVPRPLAALKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLR
CKMCKVSVHLWCSEEISHQQCPGKTSTSFRRNFSSPLLVHEPPPVCATSKESPPTGDSGKVDPVYETLRY
GTSLALMNRSSFSSTSESPTRSLSERDELTEDGEGSIRSSEEGPGDSASPVFTAPAESEGPGPEEKSPGQ
QLPKATLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVR
PGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_945344
RefSeq Size 3227
RefSeq ORF 1233
Synonyms 24b2; 24b2/STAC2
Locus ID 342667
UniProt ID Q6ZMT1
Cytogenetics 17q12
Summary This gene encodes a protein containing an SH3 domain and a zinc finger domain. The encoded protein has been shown to regulate calcium channel inactivation in a human cell line. Reduced expression of this gene has been observed in human heart failure. provided by RefSeq, May 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STAC2" proteins (3)
SKU Description Size Price
LC404706 Lyophilized STAC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404706 Transient overexpression lysate of SH3 and cysteine rich domain 2 (STAC2) (as WB positive control) 100 ug
$436.00
TP312302 Recombinant protein of human SH3 and cysteine rich domain 2 (STAC2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products