OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SCAI (NM_173690) Human Mass Spec Standard

Be the first to review this product
SKU
PH312280
SCAI MS Standard C13 and N15-labeled recombinant protein (NP_775961)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA385209 SCAI Rabbit monoclonal Antibody
100 ul
$380.00
LY406562 Transient overexpression lysate of suppressor of cancer cell invasion (SCAI), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "SCAI or NM_173690"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212280
Predicted MW 72.8 kDa
Protein Sequence
Protein Sequence
>RC212280 representing NM_173690
Red=Cloning site Green=Tags(s)

MVRGARQPQQPRSRLAPRLTGTVEKPPRKRRSSIRGSGDSSHSQSQGERYQHFTEKTEFALKEIMSSGGA
EDDIPQGERKTVTDFCYLLDKSKQLFNGLRDLPQYGQKQWQSYFGRTFDVYTKLWKFQQQHRQVLDNRYG
LKRWQIGEIASKIGQLYYHYYLRTSETSYLNEAFSFYSAIRQRSYYSQVNKEDRPELVVKKLRYYARFIV
VCLLLNKMDVVKDLVKELSDEIEDYTHRFNTEDQVEWNLVLQEVAAFIEADPVMVLNDDNTIVITSNRLA
ETGAPLLEQGMIVGQLSLADALIIGNCNNQVKFSELTVDMFRMLQALEREPMNLASQMNKPGMQESADKP
TRRENPHKYLLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDI
INGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFTNLFGQPLVCLLSPTAYPKALQD
QSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFL
RLLLTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETVENPHLQKHILELASILDVRNVFFENTIDDY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775961
RefSeq Size 1968
RefSeq ORF 1887
Synonyms C9orf126; NET40
Locus ID 286205
UniProt ID Q8N9R8
Cytogenetics 9q33.3
Summary This gene encodes a regulator of cell migration. The encoded protein appears to function in the RhoA (ras homolog gene family, member A)-Dia1 (diaphanous homolog 1) signal transduction pathway. Alternatively spliced transcript variants have been described. provided by RefSeq, Feb 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SCAI" proteins (3)
SKU Description Size Price
LC406562 Lyophilized SCAI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406562 Transient overexpression lysate of suppressor of cancer cell invasion (SCAI), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP312280 Recombinant protein of human chromosome 9 open reading frame 126 (C9orf126), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products