OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EDF1 (NM_153200) Human Mass Spec Standard

Be the first to review this product
SKU
PH312036
EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_694880)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810774 EDF1 mouse monoclonal antibody,clone OTI7B6 100 ul
$447.00
LY418427 Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant alpha (as WB positive control) 100 ug
$436.00

Other products for "EDF1 or NM_153200"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212036
Predicted MW 15.3 kDa
Protein Sequence
Protein Sequence
>RC212036 representing NM_153200
Red=Cloning site Green=Tags(s)

MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH
DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGECPSTLRRVR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_694880
RefSeq Size 538
RefSeq ORF 417
Synonyms CFAP280; EDF-1; MBF1
Locus ID 8721
UniProt ID O60869
Cytogenetics 9q34.3
Summary This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EDF1" proteins (8)
SKU Description Size Price
PH301996 EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_003783) 10 ug
$3,360.00
LC407133 Lyophilized EDF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418427 Lyophilized EDF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407133 Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant beta (as WB positive control) 100 ug
$436.00
LY418427 Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant alpha (as WB positive control) 100 ug
$436.00
TP301996 Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, 20 µg 20 ug
$867.00
TP312036 Purified recombinant protein of Homo sapiens endothelial differentiation-related factor 1 (EDF1), transcript variant beta, 20 µg 20 ug
$867.00
TP720515 Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products