DISC1 (NM_018662) Human Mass Spec Standard

SKU
PH312015
DISC1 MS Standard C13 and N15-labeled recombinant protein (NP_061132)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212015]
Predicted MW 93.4 kDa
Protein Sequence
Protein Sequence
>RC212015 representing NM_018662
Red=Cloning site Green=Tags(s)

MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGG
VSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGS
AGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSF
SFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQA
ARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEV
ISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA
TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREI
EEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEI
TTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLV
LSSRNVKKLGSVKEDYNRLRREVEHQETAYETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRL
LIQSLQLQEARGSLSVEDERQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEE
SYILSAELGEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA
AASCMTAGVHEAQA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061132
RefSeq Size 7069
RefSeq ORF 2562
Synonyms C1orf136; SCZD9
Locus ID 27185
UniProt ID Q9NRI5
Cytogenetics 1q42.2
Summary This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. This gene is disrupted in a t(1;11)(q42.1;q14.3) translocation which segregates with schizophrenia and related psychiatric disorders in a large Scottish family. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DISC1 (NM_018662) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402701 DISC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431332 DISC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431372 DISC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431469 DISC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431473 DISC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431560 DISC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402701 Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant L 100 ug
$665.00
LY431332 Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant q 100 ug
$436.00
LY431372 Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant m 100 ug
$436.00
LY431469 Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant l 100 ug
$436.00
LY431473 Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant k 100 ug
$436.00
LY431560 Transient overexpression lysate of disrupted in schizophrenia 1 (DISC1), transcript variant f 100 ug
$665.00
TP312015 Recombinant protein of human disrupted in schizophrenia 1 (DISC1), transcript variant L, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.