OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF704 (NM_001033723) Human Mass Spec Standard

Be the first to review this product
SKU
PH312004
ZNF704 MS Standard C13 and N15-labeled recombinant protein (NP_001028895)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422418 Transient overexpression lysate of zinc finger protein 704 (ZNF704) (as WB positive control) 100 ug
$436.00

Other products for "ZNF704 or NM_001033723"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212004
Predicted MW 45.1 kDa
Protein Sequence
Protein Sequence
>RC212004 representing NM_001033723
Red=Cloning site Green=Tags(s)

MTFTFQSEDLKRDCGKKMSHQHVFSLAMEEDVKTADTKKASRILDHEKENTRSICLLEQKRKVVSSNIDV
PPARKSSEELDMDKVTAAMVLTSLSTSPLVRSPPVRPNESLSGSWKEGGCVPSSTSSSGYWSWSAPSDQS
NPSTPSPPLSADSFKPFRSPAQPDDGIDEAEASNLLFDEPIPRKRKNSMKVMFKCLWKNCGKVLSTAAGI
QKHIRTIHLGRVGDSDYSDGEEDFYYTEIKLNTDSVADGLSSLAPVSPSQSLASPPTFPIPDSSRTETPC
AKTETKLMTPLSRSAPTTLYLVHTDHAYQATPPVTIPGSAKFTPNGSSFSISWQSPPVTFTGIPVSPTHH
PVGTGEQRQHAHTVLSSPPRGTVSLRKPRGEGKKCRKVYGMENRDMWCTACRWKKACQRFLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028895
RefSeq Size 4303
RefSeq ORF 1236
Synonyms Gig1
Locus ID 619279
UniProt ID Q6ZNC4
Cytogenetics 8q21.13
Summary Transcription factor which binds to RE2 sequence elements in the MYOD1 enhancer.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF704" proteins (3)
SKU Description Size Price
LC422418 Lyophilized ZNF704 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422418 Transient overexpression lysate of zinc finger protein 704 (ZNF704) (as WB positive control) 100 ug
$436.00
TP312004 Recombinant protein of human zinc finger protein 704 (ZNF704), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products