OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CAPSL (NM_144647) Human Mass Spec Standard

Be the first to review this product
SKU
PH311974
CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_653248)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY408188 Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CAPSL or NM_144647"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211974
Predicted MW 23.1 kDa
Protein Sequence
Protein Sequence
>RC211974 protein sequence
Red=Cloning site Green=Tags(s)

MAIQAKKKLTTATNPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEV
EELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAFRKLDKTGDGVITIEDLREVYNAKHHPKYQN
GEWSEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASIDTDVYFIIMMRTAWKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_653248
RefSeq Size 1019
RefSeq ORF 594
Locus ID 133690
UniProt ID Q8WWF8
Cytogenetics 5p13.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CAPSL" proteins (7)
SKU Description Size Price
PH305410 CAPSL MS Standard C13 and N15-labeled recombinant protein (NP_001036090) 10 ug
$3,360.00
LC408188 Lyophilized CAPSL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421009 Lyophilized CAPSL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408188 Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421009 Transient overexpression lysate of calcyphosine-like (CAPSL), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP305410 Recombinant protein of human calcyphosine-like (CAPSL), transcript variant 2, 20 µg 20 ug
$867.00
TP311974 Recombinant protein of human calcyphosine-like (CAPSL), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products