OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMSB4XP8 (NM_183049) Human Mass Spec Standard

Be the first to review this product
SKU
PH311946
TMSL3 MS Standard C13 and N15-labeled recombinant protein (NP_898870)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY405218 Transient overexpression lysate of thymosin-like 3 (TMSL3) (as WB positive control) 100 ug
$436.00

Other products for "TMSL3 or NM_183049"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211946
Predicted MW 5.1 kDa
Protein Sequence
Protein Sequence
>RC211946 protein sequence
Red=Cloning site Green=Tags(s)

MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_898870
RefSeq Size 634
RefSeq ORF 132
Synonyms OTTHUMP00000161564; thymosin-like 3
Locus ID 7117
Cytogenetics 4q22.1
Protein Pathways Regulation of actin cytoskeleton
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMSL3" proteins (3)
SKU Description Size Price
LC405218 Lyophilized TMSL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405218 Transient overexpression lysate of thymosin-like 3 (TMSL3) (as WB positive control) 100 ug
$436.00
TP311946 Recombinant protein of human thymosin-like 3 (TMSL3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products