OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VENTX (NM_014468) Human Mass Spec Standard

Be the first to review this product
SKU
PH311761
VENTX MS Standard C13 and N15-labeled recombinant protein (NP_055283)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319895 Rabbit Polyclonal VENTX Antibody
100 ug
$640.00
LY415250 Transient overexpression lysate of VENT homeobox homolog (Xenopus laevis) (VENTX) (as WB positive control) 100 ug
$436.00

Other products for "VENTX or NM_014468"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211761
Predicted MW 27.5 kDa
Protein Sequence
Protein Sequence
>RC211761 protein sequence
Red=Cloning site Green=Tags(s)

MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSPGSLPGPGQTSGAREPPQAVSIKEAAGSS
NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQ
NRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQ
EALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055283
RefSeq Size 2422
RefSeq ORF 774
Synonyms HPX42B; NA88A; VENTX2
Locus ID 27287
UniProt ID O95231
Cytogenetics 10q26.3
Summary This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VENTX" proteins (3)
SKU Description Size Price
LC415250 Lyophilized VENTX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415250 Transient overexpression lysate of VENT homeobox homolog (Xenopus laevis) (VENTX) (as WB positive control) 100 ug
$436.00
TP311761 Recombinant protein of human VENT homeobox homolog (Xenopus laevis) (VENTX), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products