OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

POC5 (NM_152408) Human Mass Spec Standard

Be the first to review this product
SKU
PH311731
POC5 MS Standard C13 and N15-labeled recombinant protein (NP_689621)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA356764 POC5 Antibody - C-terminal region
100 ul
$585.00
LY407576 Transient overexpression lysate of chromosome 5 open reading frame 37 (C5orf37), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "POC5 or NM_152408"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211731
Predicted MW 60.8 kDa
Protein Sequence
Protein Sequence
>RC211731 protein sequence
Red=Cloning site Green=Tags(s)

MKWEEYEELLHYAIVTPNIEPCASQSSHPKGELVPDVRISTIHDILHSQGNNSEVRETAIEVGKGCDFHI
SSHSKTDESSPVLSPRKPSHPVMDFFSSHLLADSSSPATNSSHTDAHEILVSDFLVSDENLQKMENVLDL
WSSGLKTNIISELSKWRLNFIDWHRMEMRKEKEKHAAHLKQLCNQINELKELQKTFEISIGRKDEVISSL
SHAIGKQKEKIELMRTFFHWRIGHVRARQDVYEGKLADQYYQRTLLKKVWKVWRSVVQKQWKDVVERACQ
ARAEEVCIQISNDYEAKVAMLSGALENAKAEIQRMQHEKEHFEDSMKKAFMRGVCALNLEAMTIFQNRND
AGIDSTNNKKEEYGPGVQGKEHSAHLDPSAPPMPLPVTSPLLPSPPAAVGGASATAVPSAASMTSTRAAS
ASSVHVPVSALGAGSAATAASEEMYVPRVVTSAQQKAGRTITARITGRCDFASKNRISSSLAIMGVSPPM
SSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGTRSAHTQSLTSVHSIKVVD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689621
RefSeq Size 1969
RefSeq ORF 1650
Synonyms C5orf37
Locus ID 134359
UniProt ID Q8NA72
Cytogenetics 5q13.3
Summary Essential for the assembly of the distal half of centrioles, required for centriole elongation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "POC5" proteins (3)
SKU Description Size Price
LC407576 Lyophilized POC5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407576 Transient overexpression lysate of chromosome 5 open reading frame 37 (C5orf37), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP311731 Recombinant protein of human chromosome 5 open reading frame 37 (C5orf37), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products