OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB12 (NM_001025300) Human Mass Spec Standard

Be the first to review this product
SKU
PH311472
RAB12 MS Standard C13 and N15-labeled recombinant protein (NP_001020471)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422432 Transient overexpression lysate of RAB12, member RAS oncogene family (RAB12) (as WB positive control) 100 ug
$436.00

Other products for "RAB12 or NM_001025300"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211472
Predicted MW 27.1 kDa
Protein Sequence
Protein Sequence
>RC211472 representing NM_001025300
Red=Cloning site Green=Tags(s)

MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA
CKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMI
DKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPL
DILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020471
RefSeq Size 2138
RefSeq ORF 732
Locus ID 201475
UniProt ID Q6IQ22
Cytogenetics 18p11.22
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB12" proteins (3)
SKU Description Size Price
LC422432 Lyophilized RAB12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422432 Transient overexpression lysate of RAB12, member RAS oncogene family (RAB12) (as WB positive control) 100 ug
$436.00
TP311472 Recombinant protein of human RAB12, member RAS oncogene family (RAB12), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products