OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLURP1 (NM_020427) Human Mass Spec Standard

Be the first to review this product
SKU
PH311275
SLURP1 MS Standard C13 and N15-labeled recombinant protein (NP_065160)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY412478 Transient overexpression lysate of secreted LY6/PLAUR domain containing 1 (SLURP1) (as WB positive control) 100 ug
$436.00

Other products for "SLURP1 or NM_020427"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211275
Predicted MW 11.2 kDa
Protein Sequence
Protein Sequence
>RC211275 protein sequence
Red=Cloning site Green=Tags(s)

MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT
RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065160
RefSeq Size 537
RefSeq ORF 309
Synonyms ANUP; ARS; ArsB; LY6-MT; LY6LS; MDM
Locus ID 57152
UniProt ID P55000
Cytogenetics 8q24.3
Summary The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SLURP1" proteins (3)
SKU Description Size Price
LC412478 Lyophilized SLURP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412478 Transient overexpression lysate of secreted LY6/PLAUR domain containing 1 (SLURP1) (as WB positive control) 100 ug
$436.00
TP311275 Recombinant protein of human secreted LY6/PLAUR domain containing 1 (SLURP1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products