OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cyclin B2 (CCNB2) (NM_004701) Human Mass Spec Standard

Be the first to review this product
SKU
PH311260
CCNB2 MS Standard C13 and N15-labeled recombinant protein (NP_004692)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA590623 Rabbit Polyclonal Cyclin B2 Antibody
100 ug
$482.00
LY417829 Transient overexpression lysate of cyclin B2 (CCNB2) (as WB positive control) 100 ug
$436.00

Other products for "Cyclin B2 or NM_004701"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211260
Predicted MW 45.3 kDa
Protein Sequence
Protein Sequence
>RC211260 protein sequence
Red=Cloning site Green=Tags(s)

MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNK
QLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQ
YLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQL
VGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVD
VEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKN
VVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004692
RefSeq Size 1566
RefSeq ORF 1194
Synonyms HsT17299
Locus ID 9133
UniProt ID O95067
Cytogenetics 15q22.2
Summary Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Cell cycle, Oocyte meiosis, p53 signaling pathway, Progesterone-mediated oocyte maturation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Cyclin B2" proteins (3)
SKU Description Size Price
LC417829 Lyophilized CCNB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417829 Transient overexpression lysate of cyclin B2 (CCNB2) (as WB positive control) 100 ug
$436.00
TP311260 Recombinant protein of human cyclin B2 (CCNB2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products