Cyclin B2 (CCNB2) (NM_004701) Human Mass Spec Standard

CAT#: PH311260

CCNB2 MS Standard C13 and N15-labeled recombinant protein (NP_004692)

Product Images

Coomassie blue staining of purified CCNB2 protein (Cat# TP311260). The protein was produced from HEK293T cells transfected with CCNB2 cDNA clone (Cat# RC211260) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC211260
• Predicted MW: 45.3 kDa
• Protein Sequence:
  Sequence Link

  >RC211260 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNK
  QLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQ
  YLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQL
  VGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVD
  VEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKN
  VVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004692
• RefSeq Size: 1566
• RefSeq ORF: 1194
• Synonyms: HsT17299
• Locus ID: 9133
• UniProt ID: O95067
• Cytogenetics: 15q22.2
• Summary: Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, Oocyte meiosis, p53 signaling pathway, Progesterone-mediated oocyte maturation