OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPC24 (NM_182513) Human Mass Spec Standard

Be the first to review this product
SKU
PH311241
SPC24 MS Standard C13 and N15-labeled recombinant protein (NP_872319)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA381921 SPC24 Rabbit polyclonal Antibody
100 ul
$410.00
LY405531 Transient overexpression lysate of SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae) (SPC24) (as WB positive control) 100 ug
$436.00

Other products for "SPC24 or NM_182513"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211241
Predicted MW 22.4 kDa
Protein Sequence
Protein Sequence
>RC211241 protein sequence
Red=Cloning site Green=Tags(s)

MAAFRDIEEVSQGLLSLLGANRAEAQQRRLLGRHEQVVERLLETQDGAEKQLREILTMEKEVAQSLLNAK
EQVHQGGVELQQLEAGLQEAGEEDTRLKASLLQLTRELEELKEIEADLERQEKEVDEDTTVTIPSAVYVA
QLYHQVSKIEWDYECEPGMVKGIHHGPSVAQPIHLDSTQLSRKFISDYLWSLVDTEW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872319
RefSeq Size 654
RefSeq ORF 591
Synonyms SPBC24
Locus ID 147841
UniProt ID Q8NBT2
Cytogenetics 19p13.2
Summary Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity (PubMed:14738735). Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore (PubMed:14738735). The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules (PubMed:23085020).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPC24" proteins (3)
SKU Description Size Price
LC405531 Lyophilized SPC24 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405531 Transient overexpression lysate of SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae) (SPC24) (as WB positive control) 100 ug
$436.00
TP311241 Recombinant protein of human SPC24, NDC80 kinetochore complex component, homolog (S. cerevisiae) (SPC24), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products