OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TMEM229B (NM_182526) Human Mass Spec Standard

Be the first to review this product
SKU
PH311212
TMEM229B MS Standard C13 and N15-labeled recombinant protein (NP_872332)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY405503 Transient overexpression lysate of transmembrane protein 229B (TMEM229B) (as WB positive control) 100 ug
$436.00

Other products for "TMEM229B or NM_182526"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211212
Predicted MW 19.5 kDa
Protein Sequence
Protein Sequence
>RC211212 protein sequence
Red=Cloning site Green=Tags(s)

MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNLNWKFPGVTSVWALFIYGTSILIVERMYLRLRGR
CPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEYAVPWFCGALIMEQFIIRNTL
RLRFDKDAEPGEPSGALALANGHVKTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872332
RefSeq Size 4068
RefSeq ORF 501
Synonyms C14orf83
Locus ID 161145
UniProt ID Q8NBD8
Cytogenetics 14q24.1
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TMEM229B" proteins (3)
SKU Description Size Price
LC405503 Lyophilized TMEM229B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405503 Transient overexpression lysate of transmembrane protein 229B (TMEM229B) (as WB positive control) 100 ug
$436.00
TP311212 Recombinant protein of human chromosome 14 open reading frame 83 (C14orf83), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products