OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RFPL1 (NM_021026) Human Mass Spec Standard

Be the first to review this product
SKU
PH311141
RFPL1 MS Standard C13 and N15-labeled recombinant protein (NP_066306)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501492 Anti-RFPL1 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3) 100 ul
$447.00
LY412149 Transient overexpression lysate of ret finger protein-like 1 (RFPL1) (as WB positive control) 100 ug
$436.00

Other products for "RFPL1 or NM_021026"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211141
Predicted MW 35.3 kDa
Protein Sequence
Protein Sequence
>RC211141 representing NM_021026
Red=Cloning site Green=Tags(s)

MAALFQEASSCPVCSDYLEKPMSLECGCAVCFKCINSLQKEPHGEDLLCCCCSMVSQKNKIRPSWQLERL
ASHIKELEPKLKKILQMNPRMRKFQVDTTLDADTANNFLISDDLRSVRSGCITQNRQDLAERFDVSICIL
GSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHRKGRIHLTTERGFWTVSLRDGSRLSASTVPLTFLFVDR
KLQRVGIFLDMGMQNVSFFDAEGGSHVYTFRSVSAEEPLHLFFAPPSPPNGDKSVLSICPVINPGTTDAP
VHPGEAK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_066306
RefSeq Size 1496
RefSeq ORF 861
Synonyms RNF78
Locus ID 5988
UniProt ID O75677
Cytogenetics 22q12.2
Summary Negatively regulates the G2-M phase transition, possibly by promoting cyclin B1/CCNB1 and CDK1 proteasomal degradation and thereby preventing their accumulation during interphase.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RFPL1" proteins (3)
SKU Description Size Price
LC412149 Lyophilized RFPL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412149 Transient overexpression lysate of ret finger protein-like 1 (RFPL1) (as WB positive control) 100 ug
$436.00
TP311141 Recombinant protein of human ret finger protein-like 1 (RFPL1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products