OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TEX13A (NM_031274) Human Mass Spec Standard

Be the first to review this product
SKU
PH311125
TEX13A MS Standard C13 and N15-labeled recombinant protein (NP_112564)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410611 Transient overexpression lysate of testis expressed 13A (TEX13A) (as WB positive control) 100 ug
$436.00

Other products for "TEX13A or NM_031274"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211125
Predicted MW 45.6 kDa
Protein Sequence
Protein Sequence
>RC211125 protein sequence
Red=Cloning site Green=Tags(s)

MALRPEDPSSGFRHSNVVAFINEKMARHTKGPEFYLENISLSWEKVEDKLRAILEDSEVPSEVKEACTWG
SLALGVRFAHRQAQLQRHRVRWLHGFAKLHKSAAQALASDLKKLREQQETERKEAASRLRMAQTSLVEVQ
KERDKELVSPHEWEQGAGWPGLATAGGVCTEGAAEEEEEAAVAAAGAAGGKGAEEEQRDVEVVAAPVEAM
APPVEAGAAPMETQFPHVEARAASMETTEKLERILLQLLGDADQEKYTYWGQKEGDLRSVETATSYFSGT
TNPWSRASSEPLPVQLPASYSYSYSSPFSSFSDIPTISPPQATVTAPVPPQLPSDWEAFDTSLWSDGGPH
RIDHQEHPRDRRYSEPHQQRPPVYRRPGDWDCPWCNAVNFSRRDTCFDCGKGIWLQKPH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112564
RefSeq Size 1409
RefSeq ORF 1227
Locus ID 56157
UniProt ID Q9BXU3
Cytogenetics Xq22.3
Summary This gene is similar to a mouse gene that is expressed in the testis. Alternative splicing results in multiple transcript variants. provided by RefSeq, Mar 2014
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TEX13A" proteins (3)
SKU Description Size Price
LC410611 Lyophilized TEX13A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410611 Transient overexpression lysate of testis expressed 13A (TEX13A) (as WB positive control) 100 ug
$436.00
TP311125 Recombinant protein of human testis expressed 13A (TEX13A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products