OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC1 (NM_022365) Human Mass Spec Standard

Be the first to review this product
SKU
PH311118
DNAJC1 MS Standard C13 and N15-labeled recombinant protein (NP_071760)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA338496 Rabbit Polyclonal Anti-DNAJC1 Antibody
100 ul
$585.00
LY411690 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 1 (DNAJC1) (as WB positive control) 100 ug
$436.00

Other products for "DNAJC1 or NM_022365"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211118
Predicted MW 63.9 kDa
Protein Sequence
Protein Sequence
>RC211118 protein sequence
Red=Cloning site Green=Tags(s)

MTAPCSQPAQLPGRRQLGLVPFPPPPPRTPLLWLLLLLLAAVAPARGWESGDLELFDLVEEVQLNFYQFL
GVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDILINGLPDWRQPV
FYYRRVRKMSNAELALLLFIILTVGHYAVVWSIYLEKQLDELLSRKKREKKKKTGSKSVDVSKLGASEKN
ERLLMKPQWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRTELETLQKQKKVKK
PKPEFPVYTPLETTYIQSYDHGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEEDLSQLTRSMVKFPGGTP
GRWEKIAHELGRSVTDVTTKAKQLKDSVTCSPGMVRLSELKSTVQNSRPIKTATTLPDDMITQREDAEGV
AAEEEQEGDSGEQETGATDARPRRRKPARLLEATAKPEPEEKSRAKRQKDFDIAEQNESSDEESLRKERA
RSAEEPWTQNQQKLLELALQQYPRGSSDRWDKIARCVPSKSKEDCIARYKLLVELVQKKKQAKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_071760
RefSeq Size 2213
RefSeq ORF 1662
Synonyms DNAJL1; ERdj1; HTJ1; MTJ1
Locus ID 64215
UniProt ID Q96KC8
Cytogenetics 10p12.31
Summary The membrane protein encoded by this gene is a DNAJ-like heat shock protein that binds the molecular chaperone BiP. In addition, the encoded protein contains two SANT domains that have been shown to bind serpin alpha1-antichymotrypsin and inter-alpha trypsin inhibitor heavy chain 4. provided by RefSeq, Jul 2016
Protein Families Transcription Factors, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC1" proteins (3)
SKU Description Size Price
LC411690 Lyophilized DNAJC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411690 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 1 (DNAJC1) (as WB positive control) 100 ug
$436.00
TP311118 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 1 (DNAJC1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products