OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CTU2 (NM_001012759) Human Mass Spec Standard

Be the first to review this product
SKU
PH311052
CTU2 MS Standard C13 and N15-labeled recombinant protein (NP_001012777)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375228 CTU2 Rabbit polyclonal Antibody
100 ul
$410.00
LY422834 Transient overexpression lysate of cytosolic thiouridylase subunit 2 homolog (S. pombe) (CTU2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CTU2 or NM_001012759"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211052
Predicted MW 56.1 kDa
Protein Sequence
Protein Sequence
>RC211052 protein sequence
Red=Cloning site Green=Tags(s)

MCQVGEDYGEPAPEEPPPAPRPSREQKCVKCKEAQPVVVIRAGDAFCRDCFKAFYVHKFRAMLGKNRLIF
PGEKVLLAWSGGPSSSSMVWQVLEGLSQDSAKRLRFVAGVIFVDEGAACGQSLEERSKTLAEVKPILQAT
GFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQHVLGAGGGPGPTQGEEQPPQPPLDP
QNLARPPAPAQTEALSQLFCSVRTLTAKEELLQTLRTHLILHMARAHGYSKVMTGDSCTRLAIKLMTNLA
LGRGAFLAWDTGFSDERHGDVVVVRPMRDHTLKEVAFYNRLFSVPSVFTPAVDTKAPEKASIHRLMEAFI
LRLQTQFPSTVSTVYRTSEKLVKGPRDGPAAGDSGPRCLLCMCALDVDAADSATAFGAQTSSRLSQMQSP
IPLTETRTPPGPCCSPGVGWAQRCGQGACRREDPQACIEEQLCYSCRVNMKDLPSLDPLPPYILAEAQLR
TQRAWGLQEIRDCLIEDSDDEAGQS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001012777
RefSeq Size 1740
RefSeq ORF 1545
Synonyms C16orf84; MFRG; NCS2; UPF0432
Locus ID 348180
UniProt ID Q2VPK5
Cytogenetics 16q24.3
Summary This gene encodes a protein which is involved in the post-transcriptional modification of transfer RNAs (tRNAs). The encoded protein plays a role in thiolation of uridine residue present at the wobble position in a subset of tRNAs, resulting in enhanced codon reading accuracy. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jan 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CTU2" proteins (3)
SKU Description Size Price
LC422834 Lyophilized CTU2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422834 Transient overexpression lysate of cytosolic thiouridylase subunit 2 homolog (S. pombe) (CTU2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP311052 Recombinant protein of human chromosome 16 open reading frame 84 (C16orf84), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products