OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CTRP3 (C1QTNF3) (NM_030945) Human Mass Spec Standard

Be the first to review this product
SKU
PH311047
C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_112207)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY405756 Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CTRP3 or NM_030945"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211047
Predicted MW 27 kDa
Protein Sequence
Protein Sequence
>RC211047 protein sequence
Red=Cloning site Green=Tags(s)

MLWRQLIYWQLLALFFLPFCLCQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGN
NGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSV
ETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVL
KLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112207
RefSeq Size 3624
RefSeq ORF 738
Synonyms C1ATNF3; CORCS; CORS; CORS-26; CORS26; CTRP3
Locus ID 114899
UniProt ID Q9BXJ4
Cytogenetics 5p13.2
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CTRP3" proteins (7)
SKU Description Size Price
PH313742 C1QTNF3 MS Standard C13 and N15-labeled recombinant protein (NP_852100) 10 ug
$3,360.00
LC405756 Lyophilized C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410641 Lyophilized C1QTNF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405756 Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410641 Transient overexpression lysate of C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP311047 Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 1, 20 µg 20 ug
$867.00
TP313742 Recombinant protein of human C1q and tumor necrosis factor related protein 3 (C1QTNF3), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products