OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

H2BC18 (NM_001024599) Human Mass Spec Standard

Be the first to review this product
SKU
PH311042
HIST2H2BF MS Standard C13 and N15-labeled recombinant protein (NP_001019770)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336063 Rabbit Polyclonal Anti-HIST2H2BF Antibody
100 ul
$585.00
LY422516 Transient overexpression lysate of histone cluster 2, H2bf (HIST2H2BF), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "H2BC18 or NM_001024599"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211042
Predicted MW 13.9 kDa
Protein Sequence
Protein Sequence
>RC211042 protein sequence
Red=Cloning site Green=Tags(s)

MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001019770
RefSeq Size 495
RefSeq ORF 378
Synonyms HIST2H2BF
Locus ID 440689
UniProt ID Q5QNW6
Cytogenetics 1q21.2
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family and is found in a histone cluster on chromosome 1. provided by RefSeq, Aug 2015
Protein Pathways Systemic lupus erythematosus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "H2BC18" proteins (3)
SKU Description Size Price
LC422516 Lyophilized HIST2H2BF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422516 Transient overexpression lysate of histone cluster 2, H2bf (HIST2H2BF), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP311042 Recombinant protein of human histone cluster 2, H2bf (HIST2H2BF), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products