OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

THEM5 (NM_182578) Human Mass Spec Standard

Be the first to review this product
SKU
PH310954
THEM5 MS Standard C13 and N15-labeled recombinant protein (NP_872384)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA365257 THEM5 rabbit polyclonal antibody
100 ul
$310.00
LY405467 Transient overexpression lysate of thioesterase superfamily member 5 (THEM5) (as WB positive control) 100 ug
$436.00

Other products for "THEM5 or NM_182578"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210954
Predicted MW 27.7 kDa
Protein Sequence
Protein Sequence
>RC210954 protein sequence
Red=Cloning site Green=Tags(s)

MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNASWCSDMLSLY
QEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCIQVEGQGFEYVIFFQPTQKKS
VCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEGLFTLSLNIRFKNLIPVDSLVVMDVEVDKIE
DQKLYMSCIAHSRDQQTVYAKSSGVFLQLQLEEESPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_872384
RefSeq Size 1146
RefSeq ORF 741
Synonyms ACOT15
Locus ID 284486
UniProt ID Q8N1Q8
Cytogenetics 1q21.3
Summary Has acyl-CoA thioesterase activity towards long-chain (C16 and C18) fatty acyl-CoA substrates, with a preference for linoleoyl-CoA and other unsaturated long-chain fatty acid-CoA esters (PubMed:22586271). Plays an important role in mitochondrial fatty acid metabolism, and in remodeling of the mitochondrial lipid cardiolipin (PubMed:22586271). Required for normal mitochondrial function (PubMed:22586271).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "THEM5" proteins (3)
SKU Description Size Price
LC405467 Lyophilized THEM5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405467 Transient overexpression lysate of thioesterase superfamily member 5 (THEM5) (as WB positive control) 100 ug
$436.00
TP310954 Recombinant protein of human thioesterase superfamily member 5 (THEM5), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products