OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WFDC6 (NM_080827) Human Mass Spec Standard

Be the first to review this product
SKU
PH310952
WFDC6 MS Standard C13 and N15-labeled recombinant protein (NP_543017)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY409030 Transient overexpression lysate of WAP four-disulfide core domain 6 (WFDC6) (as WB positive control) 100 ug
$436.00

Other products for "WFDC6 or NM_080827"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210952
Predicted MW 9.7 kDa
Protein Sequence
Protein Sequence
>RC210952 protein sequence
Red=Cloning site Green=Tags(s)

MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCL
DFRKVSLTLYHKEELE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_543017
RefSeq Size 619
RefSeq ORF 258
Synonyms C20orf171; dJ461P17.11; HEL-S-295; WAP6
Locus ID 140870
UniProt ID Q9BQY6
Cytogenetics 20q13.12
Summary This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Read-through transcription exists between this gene and the upstream SPINLW1 (serine peptidase inhibitor-like, with Kunitz and WAP domains 1) gene. provided by RefSeq, Nov 2010
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WFDC6" proteins (3)
SKU Description Size Price
LC409030 Lyophilized WFDC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409030 Transient overexpression lysate of WAP four-disulfide core domain 6 (WFDC6) (as WB positive control) 100 ug
$436.00
TP310952 Recombinant protein of human WAP four-disulfide core domain 6 (WFDC6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products