OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PMS2P3 (NM_005395) Human Mass Spec Standard

Be the first to review this product
SKU
PH310950
PMS2L3 MS Standard C13 and N15-labeled recombinant protein (NP_005386)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY417332 Transient overexpression lysate of postmeiotic segregation increased 2-like 3 (PMS2L3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PMS2L3 or NM_005395"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210950
Predicted MW 18.9 kDa
Protein Sequence
Protein Sequence
>RC210950 protein sequence
Red=Cloning site Green=Tags(s)

MNTLQGPVSFKDVAVDFTQEEWRQLDPDEKIAYGDVMLENYSHLVSVGYDYHQAKHHHGVEVKEVEQGEE
PWIMEGEFPCQHSPEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDL
IEVSDNGCGVEEENFEGLTMSPFLPATRR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005386
RefSeq Size 1329
RefSeq ORF 507
Synonyms MGC126647; PMS2L9; PMS5; PMSR3; postmeiotic segregation increased 2-like 3; postmeiotic segregation increased 2-like 9
Locus ID 5387
Cytogenetics 7q11.23
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PMS2L3" proteins (3)
SKU Description Size Price
LC417332 Lyophilized PMS2L3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417332 Transient overexpression lysate of postmeiotic segregation increased 2-like 3 (PMS2L3), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310950 Recombinant protein of human postmeiotic segregation increased 2-like 3 (PMS2L3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products