OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SDR O (SDR9C7) (NM_148897) Human Mass Spec Standard

Be the first to review this product
SKU
PH310941
SDR9C7 MS Standard C13 and N15-labeled recombinant protein (NP_683695)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501723 SDR9C7 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5) 100 ul
$447.00
LY407754 Transient overexpression lysate of short chain dehydrogenase/reductase family 9C, member 7 (SDR9C7) (as WB positive control) 100 ug
$436.00

Other products for "SDR O or NM_148897"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210941
Predicted MW 35.3 kDa
Protein Sequence
Protein Sequence
>RC210941 protein sequence
Red=Cloning site Green=Tags(s)

MAALTDLSFMYRWFKNCNLVGNLSEKYVFITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTS
YRLQTTLLDVTKSESIKAAAQWVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKVINVNLVGLIEV
TLHMLPMVKRARGRVVNMSSSGGRVAVIGGGYCVSKFGVEAFSDSIRRELYYFGVKVCIIEPGNYRTAIL
GKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKNIMQVAEPRVRDVINSMEHAIVSRSPRIRYNPG
LDAKLLYIPLAKLPTPVTDFILSRYLPRPADSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_683695
RefSeq Size 1765
RefSeq ORF 939
Synonyms ARCI13; RDHS; SDR-O; SDRO
Locus ID 121214
UniProt ID Q8NEX9
Cytogenetics 12q13.3
Summary This gene encodes a protein with similarity to the short-chain dehydrogenase/reductase (SDR) family but has not been shown to have retinoid or dehydrogenase activities. provided by RefSeq, Apr 2010
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SDR O" proteins (3)
SKU Description Size Price
LC407754 Lyophilized SDR9C7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407754 Transient overexpression lysate of short chain dehydrogenase/reductase family 9C, member 7 (SDR9C7) (as WB positive control) 100 ug
$436.00
TP310941 Recombinant protein of human short chain dehydrogenase/reductase family 9C, member 7 (SDR9C7), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products