OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFNA13 (IFNA1) (NM_024013) Human Mass Spec Standard

Be the first to review this product
SKU
PH310902
IFNA1 MS Standard C13 and N15-labeled recombinant protein (NP_076918)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA377346 Interferon alpha 1 (IFN-α1) Rabbit polyclonal Antibody
100 ul
$410.00
LY402974 Transient overexpression lysate of interferon, alpha 1 (IFNA1) (as WB positive control) 100 ug
$436.00

Other products for "IFNA13 or NM_024013"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210902
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC210902 protein sequence
Red=Cloning site Green=Tags(s)

MASPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQ
FQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSI
LAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_076918
RefSeq Size 863
RefSeq ORF 567
Synonyms IFL; IFN; IFN-ALPHA; IFN-alphaD; IFNA13; IFNA@; leIF D
Locus ID 3439
UniProt ID P01562
Cytogenetics 9p21.3
Summary This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded cytokine is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia. provided by RefSeq, Aug 2020
Protein Families Druggable Genome
Protein Pathways Antigen processing and presentation, Autoimmune thyroid disease, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Regulation of autophagy, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IFNA13" proteins (4)
SKU Description Size Price
LC402974 Lyophilized IFNA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402974 Transient overexpression lysate of interferon, alpha 1 (IFNA1) (as WB positive control) 100 ug
$436.00
TP310902 Recombinant protein of human interferon, alpha 1 (IFNA1), 20 µg 20 ug
$867.00
TP721103 Purified recombinant protein of Human interferon, alpha 1 (IFNA1) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products