OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRHDE-AS1 (NM_001025457) Human Mass Spec Standard

Be the first to review this product
SKU
PH310873
LOC283392 MS Standard C13 and N15-labeled recombinant protein (NP_001020628)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY422445 Transient overexpression lysate of hypothetical protein LOC283392 (LOC283392) (as WB positive control) 100 ug
$436.00

Other products for "LOC283392 or NM_001025457"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210873
Predicted MW 11.8 kDa
Protein Sequence
Protein Sequence
>RC210873 representing NM_001025457
Red=Cloning site Green=Tags(s)

MLPPPLRACGSRLSLPCAALSPRFPREPSNRFSAREKDGSGGKSEGVEREVRAFAFSPHSSGGVRSSGWN
VLAAAVTAATAREAPEPYTLQLERKGWPRWERLE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020628
RefSeq Size 430
RefSeq ORF 312
Locus ID 283392
Cytogenetics 12q21.1
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LOC283392" proteins (3)
SKU Description Size Price
LC422445 Lyophilized LOC283392 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422445 Transient overexpression lysate of hypothetical protein LOC283392 (LOC283392) (as WB positive control) 100 ug
$436.00
TP310873 Recombinant protein of human hypothetical protein LOC283392 (LOC283392), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products