TRHDE-AS1 (NM_001025457) Human Mass Spec Standard

CAT#: PH310873

LOC283392 MS Standard C13 and N15-labeled recombinant protein (NP_001020628)

Product Images

Coomassie blue staining of purified LOC283392 protein (Cat# TP310873). The protein was produced from HEK293T cells transfected with LOC283392 cDNA clone (Cat# RC210873) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210873
• Predicted MW: 11.8 kDa
• Protein Sequence:
  Sequence Link

  >RC210873 representing NM_001025457
  Red=Cloning site Green=Tags(s)
  
  MLPPPLRACGSRLSLPCAALSPRFPREPSNRFSAREKDGSGGKSEGVEREVRAFAFSPHSSGGVRSSGWN
  VLAAAVTAATAREAPEPYTLQLERKGWPRWERLE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001020628
• RefSeq Size: 430
• RefSeq ORF: 312
• Locus ID: 283392
• Cytogenetics: 12q21.1