OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNG13 (NM_016541) Human Mass Spec Standard

Be the first to review this product
SKU
PH310828
GNG13 MS Standard C13 and N15-labeled recombinant protein (NP_057625)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY413914 Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 13 (GNG13) (as WB positive control) 100 ug
$436.00

Other products for "GNG13 or NM_016541"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210828
Predicted MW 7.9 kDa
Protein Sequence
Protein Sequence
>RC210828 protein sequence
Red=Cloning site Green=Tags(s)

MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVEKGKCTIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057625
RefSeq Size 1001
RefSeq ORF 201
Synonyms G(gamma)13; h2-35
Locus ID 51764
UniProt ID Q9P2W3
Cytogenetics 16p13.3
Summary Heterotrimeric G proteins, which consist of alpha (see MIM 139320), beta (see MIM 139380), and gamma subunits, function as signal transducers for the 7-transmembrane-helix G protein-coupled receptors. GNG13 is a gamma subunit that is expressed in taste, retinal, and neuronal tissues and plays a key role in taste transduction (Li et al., 2006 PubMed 16473877).supplied by OMIM, Oct 2009
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Taste transduction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GNG13" proteins (3)
SKU Description Size Price
LC413914 Lyophilized GNG13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413914 Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma 13 (GNG13) (as WB positive control) 100 ug
$436.00
TP310828 Recombinant protein of human guanine nucleotide binding protein (G protein), gamma 13 (GNG13), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products