OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LIF (NM_002309) Human Mass Spec Standard

Be the first to review this product
SKU
PH310818
LIF MS Standard C13 and N15-labeled recombinant protein (NP_002300)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA321468 Anti-LIF Rabbit Polyclonal Antibody
100 ul
$305.00
LY400835 Transient overexpression lysate of leukemia inhibitory factor (cholinergic differentiation factor) (LIF) (as WB positive control) 100 ug
$436.00

Other products for "LIF or NM_002309"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210818
Predicted MW 22 kDa
Protein Sequence
Protein Sequence
>RC210818 protein sequence
Red=Cloning site Green=Tags(s)

MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQ
GEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNAT
ADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002300
RefSeq Size 3987
RefSeq ORF 606
Synonyms CDF; DIA; HILDA; MLPLI
Locus ID 3976
UniProt ID P15018
Cytogenetics 22q12.2
Summary The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Mar 2012
Protein Families Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LIF" proteins (6)
SKU Description Size Price
LC400835 Lyophilized LIF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400835 Transient overexpression lysate of leukemia inhibitory factor (cholinergic differentiation factor) (LIF) (as WB positive control) 100 ug
$436.00
TP310818 Recombinant protein of human leukemia inhibitory factor (cholinergic differentiation factor) (LIF), 20 µg 20 ug
$737.00
TP720015 Recombinant protein of human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) 10 ug
$275.00
TP723889 Purified recombinant protein of Human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) 10 ug
$335.00
TP750008 Recombinant protein of human leukemia inhibitory factor (LIF) produced in E. coli. 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products